- Recombinant Marinomonas sp. UPF0060 membrane protein Mmwyl1_1139 (Mmwyl1_1139)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1176935
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,251 Da
- E Coli or Yeast
- 1-110
- UPF0060 membrane protein Mmwyl1_1139 (Mmwyl1_1139)
Sequence
MPELKTISLFMLTALAEIIGCYLPYLWLREGKTIWLLVPAALSLAVFTWLLTLHPTASGRVYAAYGGVYIFMAVLWLWIVDGIRPTTWDMIGSAVALLGMAIIMFAPRTT